Trovati 76 sinonimi in 9 gruppi
  1. 1
    Significato: fleeting
    passingflittinglivelytransientvolatileshort-livedephemeraltransitory
  1. 2
    Significato: momentary
    ephemeralfleetingshortbrief
    temporarytransientmeteoricshort-lived
  2. 3
    Significato: brief
    ephemeralfleetingshortshort-lived
    temporarytransientmeteoricmomentary
  3. 4
    Significato: frail
    fragileflimsyweakephemeraldiaphanousthinimaginary
    vaporouslightunbelievablefantasticvisionaryunsubstantial
  4. 5
    Significato: volatile
    passingflittinglivelytransient
    transitoryshort-livedephemeralfleeting
  1. 6
    Significato: temporary
    interimlimitedpassingtransient
    ephemeralconditionalprovisional
  2. 7
    Significato: temporal
    humantransientmortalevanescent
    ephemeralmomentaryimpermanent
  3. 8
    Significato: duration
    momentaryephemeralfleetingshortshort-lived
    temporarytransientmeteoricbrief
  4. 9
    Significato: flimsy
    ephemeralfancifulincorporealintangible
    tenuousgossameretherealinsubstantial

ᐅ Tutti i sinonimi per ephemeral | Significati & parole simili

Sinonimi prima e dopo ephemeral

  • envious
  • enviousness
  • environment
  • environs
  • envisage
  • envision
  • envoy
  • envy
  • enzyme
  • eon
  • ephemeral
  • epic
  • epicure
  • epicurean
  • epidemic
  • epidermis
  • epigram
  • epigrammatic
  • epilepsy
  • epileptic fit
  • epilogue